PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA023595-PA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 137aa    MW: 13883.2 Da    PI: 4.5158
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA023595-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70281.62e-2566496154
            DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       +++     ++P+e+s+eavfrcvr+++vd++++elaYqtavsigGh+fkGiL+d+G+++
  BGIOSGA023595-PA   6 TSSGEGDGRFPPELSVEAVFRCVRIGAVDEADAELAYQTAVSIGGHTFKGILRDHGPAD 64 
                       344455567***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.1E-21963IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016241.5E-201462IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MVATTTSSGE GDGRFPPELS VEAVFRCVRI GAVDEADAEL AYQTAVSIGG HTFKGILRDH  60
GPADEAAGQL PPSSAEYHQL TGQGREESSP AGSSEGVGGG HGAATAATSA AVLMDPYPTP  120
IGAFAAGTQF FPHNPRT
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154699190.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642175.18e-93PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA0A0E0E6A56e-95A0A0E0E6A5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA023595-PA4e-94(Oryza sativa Indica Group)
STRINGLOC_Os06g49830.12e-92(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.18e-21Lateral root primordium (LRP) protein-related